IGF-1 LR3

Price range: $39.99 through $179.99
1
Lab Tested
Third-party verified
Ships Fast
1-2 business days
Research Use Only
This product is intended for laboratory research purposes only. Not for human or animal consumption.

Description

IGF-1 LR3 is a synthetic peptide analog supplied as a lyophilized powder for controlled laboratory workflows, analytical characterization, and peptide handling applications. Manufactured to high analytical standards, this material is typically evaluated for identity, purity, and batch consistency within research settings. For research use only. Not for human consumption. Not intended to diagnose, treat, cure, or prevent any disease. Sequence-modified peptide analog offered in a stable, lab-ready lyophilized format suitable for standard research storage and controlled reconstitution procedures.

Storage: Lyophilized material should be stored refrigerated (2–8°C), protected from light. After reconstitution, store refrigerated (2–8°C) and use within a limited research window under appropriate laboratory handling conditions.

Lab Results (COA)

Every batch is tested by an independent third-party laboratory. Download the Certificate of Analysis for complete purity and composition data.

Batch Number: BATCH-2024001
Test Date: Jan 15, 2024
Purity: 99.2%

Properties

Synonyms Long R3-IGF-1; LR3-IGF-1; IGF-1 Long R3; Long arginine 3-IGF-1
Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula C400H625N111O115S9
Molecular Weight 9117.50
Physical Appearance White lyophilized powder
Terms Laboratory research use only (Ascend Peptides). Not for human, animal, diagnostic, or household use.

2D Structure

Structural representation for reference only

Restricted Access: Research Use Only

Ascend Peptides provides materials for laboratory research purposes only. Before entering this website, you must confirm that you understand and agree to the research-use-only restrictions below.